PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462919735
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 403aa    MW: 45373.4 Da    PI: 9.8554
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462919735genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B358.89.9e-1938125194
                EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
         B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                ffkv+ p+ +++  +l++p +f  e+ +++++  + ++l+ +sg++W+vkl  + +s++  +t+GWkeFv+++ Lk +  +vF++dg sef+ vv
  462919735  38 FFKVFFPEQSGE--CLIIPFPFH-EYlEEEPN--RLISLKGPSGNTWKVKL--TSGSKGLAFTQGWKEFVSDHSLKPNHLLVFTYDGCSEFSVVV 125
                889997777665..49******9.66365544..48***************..********************************9988885555 PP

2B351.42e-16298389398
                EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
         B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                +v+t+  v++   + +p +f++e     +++k++tl d++g sW+v++ y  ++++  +t+GW +F+  n+L+  D++vF+l ++++   +v+++r
  462919735 298 QVMTKCCVHTAFFMNIPCEFVKESLP--QTNKKMTLWDPQGMSWDVNYVYYDGRCAAAFTGGWGKFAIGNNLEKFDVCVFELLKEDSI--KVHIYR 389
                566666677788899******88843..35679*****************99999**************************9876555..777766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.2E-2136130IPR015300DNA-binding pseudobarrel domain
CDDcd100172.90E-1636127No hitNo description
SuperFamilySSF1019363.14E-2136130IPR015300DNA-binding pseudobarrel domain
SMARTSM010194.5E-1638130IPR003340B3 DNA binding domain
PfamPF023622.8E-1638126IPR003340B3 DNA binding domain
PROSITE profilePS5086313.23951129IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.4E-26287389IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.89E-25289389IPR015300DNA-binding pseudobarrel domain
CDDcd100172.44E-21294389No hitNo description
SMARTSM010195.6E-14296391IPR003340B3 DNA binding domain
PROSITE profilePS5086312.731296391IPR003340B3 DNA binding domain
PfamPF023622.6E-14298389IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MGKKAIEERK DGGKEGKKEK TQRGAAKEED SIGAGKHFFK VFFPEQSGEC LIIPFPFHEY  60
LEEEPNRLIS LKGPSGNTWK VKLTSGSKGL AFTQGWKEFV SDHSLKPNHL LVFTYDGCSE  120
FSVVVLCKSG VDDKSAFGAQ PCKEIFVKAE VGLRVVDTKA AGTSKMELPA LPSVEGNGKL  180
RKRVRQMTDI MINGSALKKP ISGQKKHEKR KPEAIGSTSK EVPTFVLNSK KDLPYMLDES  240
SCSRQTRIRP KDVPRSVKSR TFRLPGVISQ RRPITEEEKD HALKRAKEFK SKNPFTFQVM  300
TKCCVHTAFF MNIPCEFVKE SLPQTNKKMT LWDPQGMSWD VNYVYYDGRC AAAFTGGWGK  360
FAIGNNLEKF DVCVFELLKE DSIKVHIYRV VPEITLLIHN SSM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A2e-1226939022142B3 domain-containing transcription factor VRN
4i1k_B2e-1226939022142B3 domain-containing transcription factor VRN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1178184KLRKRVR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978926.11e-140PREDICTED: B3 domain-containing protein Os11g0197600-like
SwissprotQ2R9D21e-109Y1176_ORYSJ; B3 domain-containing protein Os11g0197600
TrEMBLA0A0A9DCS31e-155A0A0A9DCS3_ARUDO; Uncharacterized protein
STRINGSi027380m1e-132(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44613766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.15e-25B3 family protein